
Liraglutide
Local interface preview. Product information is not approved.
Demo price: Price range: €38.00 through €65.00
At a glance
Testing
Invented interface fixtures showing where an approved test plan would appear. They are not the test plan for a real product.
- Identity by mass spectrometry
- Purity by HPLC-UV, reported as a percentage
- Net peptide content per vial
- Bacterial endotoxins by LAL, vial lines
- Heavy metals screening
- Appearance, seal and closure checked at packing
Certificate of analysis
No batch with published measurements yet.
Independent verification link not available yetSpecification
Values with a source link are checked against that source. Every other value in this table is a demo value, and an empty row is a gap.
| Also known as | liraglutide |
|---|---|
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG |
| Molecular formula | C172H265N43O51 source |
| Molecular weight | 3751.20 g/mol source |
| CAS number | 204656-20-2 source |
| PubChem CID | 16134956 source |
| Amount in vial | 5 mg or 10 mg per vial, one vial per unit |
| Form | Lyophilised powder |
| Purity | Not available yet |
| Test method | Not available yet |
| Storage, lyophilised | Not available yet |
| Storage, reconstituted | Not available yet |
| Solubility | Not available yet |
Description
Demo catalogue entry. Handling, storage, safety and intended-use information is intentionally omitted until approved source documents exist.
Documents
Safety data sheet not available yet
Product data sheet not available yet
Questions
No questions and answers released yet.