Demo content, invented for design review. Loaded 2026-08-02.

Skip to content
Capsule bottle with a printed label reading Semaglutide Capsules, studio photograph on a dark background
Demo: In stock

Semaglutide Capsules

Capsules · 3 mg / 7 mg / 14 mg

Local interface preview. Product information is not approved.

Demo price: Price range: €48.00 through €140.00

Ordering is not open yet.

At a glance

Molecular formula
C187H291N45O59 source
Molecular weight
4113.58 g/mol source
Form
Capsule, opaque, in a sealed HDPE bottle
CAS number
910463-68-2 source

Testing

Invented interface fixtures showing where an approved test plan would appear. They are not the test plan for a real product.

  • Identity by mass spectrometry
  • Purity by HPLC-UV, reported as a percentage
  • Net peptide content per vial
  • Bacterial endotoxins by LAL, vial lines
  • Heavy metals screening
  • Appearance, seal and closure checked at packing

Certificate of analysis

No batch with published measurements yet.

Independent verification link not available yet
Test results for this product

Specification

Values with a source link are checked against that source. Every other value in this table is a demo value, and an empty row is a gap.

Also known as semaglutide, capsule form
Sequence H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Molecular formula C187H291N45O59 source
Molecular weight 4113.58 g/mol source
CAS number 910463-68-2 source
PubChem CID 56843331 source
Amount in vial 3 mg, 7 mg or 14 mg per capsule, 30 capsules per bottle
Form Capsule, opaque, in a sealed HDPE bottle
Purity Not available yet
Test method Not available yet
Storage, lyophilised Not available yet
Storage, reconstituted Not available yet
Solubility Not available yet

Description

Demo catalogue entry. Handling, storage, safety and intended-use information is intentionally omitted until approved source documents exist.

Documents

Questions

No questions and answers released yet.